Loading...
Statistics
Advertisement

Camperplaatsen - Drive-In Camperpark Ouddorp aan Zee
www.camper-route.com/
Camperplaatsen aan zee, vlakbij de Brouwersdam! Een uniek park met veel faciliteiten en is het gehele jaar geopend!

Camper-route.com

Domain is redirected to: Driveincamperpark.com
Advertisement
Conversion Technology Metas Server
Camper-route.com is hosted in Netherlands . Camper-route.com uses HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Html, Javascript, Number of used javascripts: 9. First javascripts: Jquery.min.js, Jquery-noconflict.js, Jquery-migrate.min.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Apache/2.2.3 (CentOS).

Technologies in use by Camper-route.com

Technology

Number of occurences: 3
  • CSS
  • Html
  • Javascript

Advertisement

Javascripts

Number of occurences: 9
  • jquery.min.js
  • jquery-noconflict.js
  • jquery-migrate.min.js
  • widgetkit-e68091b1.js
  • warp.js
  • responsive.js
  • accordionmenu.js
  • dropdownmenu.js
  • template.js

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache/2.2.3 (CentOS)

Powered by

  • PHP/5.6.2

Google Analytics ID

  • UA-50480683-1

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Camper-route.com

SSL certificate

    • name: /C=US/ST=Virginia/L=Herndon/O=Parallels/OU=Plesk/CN=plesk/emailAddress=info@plesk.com
    • subject:
      • C: US
      • ST: Virginia
      • L: Herndon
      • O: Parallels
      • OU: Plesk
      • CN: plesk
      • emailAddress: info@plesk.com
    • hash: d045e3ce
    • issuer:
      • C: US
      • ST: Virginia
      • L: Herndon
      • O: Parallels
      • OU: Plesk
      • CN: plesk
      • emailAddress: info@plesk.com
    • version: 0
    • serialNumber: 1251711868
    • validFrom: 090831094428Z
    • validTo: 100831094428Z
    • validFrom_time_t: 1251711868
    • validTo_time_t: 1283247868
    • extensions:

    Meta - Camper-route.com

    Number of occurences: 4
    • Name:
      Content: IE=edge,chrome=1
    • Name: viewport
      Content: width=device-width, initial-scale=1
    • Name: description
      Content: Camperplaatsen aan zee, vlakbij de Brouwersdam! Een uniek park met veel faciliteiten en is het gehele jaar geopend!
    • Name: generator
      Content: MYOB

    Server / Hosting

    • IP: 84.38.227.121
    • Latitude: 52.38
    • Longitude: 4.90
    • Country: Netherlands

    Rname

    • ns1.uniserver.nl
    • ns3.uniserver.nl
    • ns2.uniserver.nl
    • relay.uniserver.nl
    • mx-up.uniserver.nl

    Target

    • postmaster.uniserver.nl

    HTTP Header Response

    HTTP/1.1 301 Moved Permanently Date: Sat, 20 Aug 2016 02:40:34 GMT Server: Apache/2.2.3 (CentOS) Location: http://www.driveincamperpark.com/ Content-Length: 326 Content-Type: text/html; charset=iso-8859-1 X-Cache: MISS from s_wx1011 X-Cache-Lookup: MISS from s_wx1011:80 Via: 1.1 s_wx1011 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 OK Date: Sat, 20 Aug 2016 02:40:36 GMT Server: Apache/2.2.3 (CentOS) X-Powered-By: PHP/5.6.2 P3P: CP="NOI ADM DEV PSAi COM NAV OUR OTRo STP IND DEM" Expires: Wed, 17 Aug 2005 00:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: eb8a837f455600165bea7e5c335a1c54=64ab2foddbtmj2jkv363s19lo6; path=/; HttpOnly Set-Cookie: 18a6ae907afb904d0c1d441c810ebbd9=nl-NL; path=/ Last-Modified: Sat, 20 Aug 2016 02:40:36 GMT X-Powered-By: PleskLin Content-Type: text/html; charset=utf-8 X-Cache: MISS from s_wx1011 X-Cache-Lookup: MISS from s_wx1011:80 Transfer-Encoding: chunked Via: 1.1 s_wx1011 (squid/3.5.20) Connection: keep-alive

    DNS

    host: camper-route.com
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 84.38.227.101
    host: camper-route.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns1.uniserver.nl
    host: camper-route.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns3.uniserver.nl
    host: camper-route.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns2.uniserver.nl
    host: camper-route.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns1.uniserver.nl
    5. rname: postmaster.uniserver.nl
    6. serial: 1357910407
    7. refresh: 14400
    8. retry: 1800
    9. expire: 604800
    10. minimum-ttl: 3600
    host: camper-route.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 20
    5. target: relay.uniserver.nl
    host: camper-route.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 20
    5. target: mx-up.uniserver.nl

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.amper-route.com, www.cdamper-route.com, www.damper-route.com, www.cramper-route.com, www.ramper-route.com, www.ctamper-route.com, www.tamper-route.com, www.cvamper-route.com, www.vamper-route.com, www.cfamper-route.com, www.famper-route.com, www.cgamper-route.com, www.gamper-route.com, www.champer-route.com, www.hamper-route.com, www.cnamper-route.com, www.namper-route.com, www.cmamper-route.com, www.mamper-route.com, www.cjamper-route.com, www.jamper-route.com, www.cmper-route.com, www.caomper-route.com, www.comper-route.com, www.capmper-route.com, www.cpmper-route.com, www.ca9mper-route.com, www.c9mper-route.com, www.camper-route.com, www.cmper-route.com, www.caimper-route.com, www.cimper-route.com, www.caumper-route.com, www.cumper-route.com, www.caper-route.com, www.campper-route.com, www.capper-route.com, www.camoper-route.com, www.caoper-route.com, www.camiper-route.com, www.caiper-route.com, www.camkper-route.com, www.cakper-route.com, www.cam.per-route.com, www.ca.per-route.com, www.camuper-route.com, www.cauper-route.com, www.camjper-route.com, www.cajper-route.com, www.camnper-route.com, www.canper-route.com, www.cam-per-route.com, www.ca-per-route.com, www.camer-route.com, www.campier-route.com, www.camier-route.com, www.campker-route.com, www.camker-route.com, www.campuer-route.com, www.camuer-route.com, www.campjer-route.com, www.camjer-route.com, www.campler-route.com, www.camler-route.com, www.campr-route.com, www.campexr-route.com, www.campxr-route.com, www.campesr-route.com, www.campsr-route.com, www.campewr-route.com, www.campwr-route.com, www.camperr-route.com, www.camprr-route.com, www.campefr-route.com, www.campfr-route.com, www.campevr-route.com, www.campvr-route.com, www.campecr-route.com, www.campcr-route.com, www.campeqr-route.com, www.campqr-route.com, www.campear-route.com, www.campar-route.com, www.campeyr-route.com, www.campyr-route.com, www.campe-route.com, www.camperi-route.com, www.campei-route.com, www.campero-route.com, www.campeo-route.com, www.camperl-route.com, www.campel-route.com, www.camperl-route.com, www.campel-route.com, www.camper.-route.com, www.campe.-route.com, www.camperroute.com, www.camper-troute.com, www.campertroute.com, www.camper-groute.com, www.campergroute.com, www.camper-hroute.com, www.camperhroute.com, www.camper-uroute.com, www.camperuroute.com, www.camper-jroute.com, www.camperjroute.com, www.camper-xroute.com, www.camperxroute.com, www.camper-sroute.com, www.campersroute.com, www.camper-aroute.com, www.camperaroute.com, www.camper-route.com, www.camperroute.com, www.camper- route.com, www.camper route.com, www.camper-oute.com, www.camper-rioute.com, www.camper-ioute.com, www.camper-rooute.com, www.camper-ooute.com, www.camper-rloute.com, www.camper-loute.com, www.camper-rloute.com, www.camper-loute.com, www.camper-r.oute.com, www.camper-.oute.com, www.camper-rute.com, www.camper-robute.com, www.camper-rbute.com, www.camper-rohute.com, www.camper-rhute.com, www.camper-rogute.com, www.camper-rgute.com, www.camper-rojute.com, www.camper-rjute.com, www.camper-romute.com, www.camper-rmute.com, www.camper-ro ute.com, www.camper-r ute.com, www.camper-rovute.com, www.camper-rvute.com, www.camper-rote.com, www.camper-rouwte.com, www.camper-rowte.com, www.camper-rouete.com, www.camper-roete.com, www.camper-rouste.com, www.camper-roste.com, www.camper-rouate.com, www.camper-roate.com, www.camper-roue.com, www.camper-routqe.com, www.camper-rouqe.com, www.camper-routae.com, www.camper-rouae.com, www.camper-rout e.com, www.camper-rou e.com, www.camper-routwe.com, www.camper-rouwe.com, www.camper-routee.com, www.camper-rouee.com, www.camper-routze.com, www.camper-rouze.com, www.camper-routxe.com, www.camper-rouxe.com, www.camper-routce.com, www.camper-rouce.com,

    Other websites we recently analyzed

    1. ## Hidráulica Vale do Aço Service ##
      Site da Hidráulica Vale do Aço service
      Curitiba (Brazil) - 177.12.174.104
      Server software: Apache
      Technology: CSS, Php
      Number of meta tags: 18
    2. Mirador Aldaya
      Mountain View (United States) - 216.58.208.33
      Server software: GSE
      Technology: CSS, Html, Html5, Iframe, Javascript, Php, Schema.org, SVG, Wordpress, Add This, Google +1 Button
      Number of Javascript: 3
      Number of meta tags: 3
    3. Mijn Talent
      Netherlands - 109.71.51.117
      Server software: Apache/2.4.18 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4 mod_fcgid/2.3.9
      Technology: CSS, Google Font API, Html, Javascript
      Number of Javascript: 3
      Number of meta tags: 2
    4. smallkitchenappliancesreviews.com
      Scottsdale (United States) - 184.168.221.104
      Server software: Microsoft-IIS/7.5
      Technology: Html
    5. Welcome to www.rolandkessel.nl
      www.rolandkessel.nl
      Netherlands - 83.96.159.15
      Server software: Apache/2
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 6
      Number of meta tags: 5
    6. performancecarsales.co.uk
      United Kingdom - 81.21.76.62
      Server software: Apache/2.2.3 (CentOS)
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 1
    7. Bible Sayings of the Fathers - sayings of moses, sayings of abraham, sayings of Isaach, sayings of Jacob
      Scottsdale (United States) - 23.229.188.67
      Server software: Apache
      Technology: CSS, Html
      Number of meta tags: 1
    8. © 2016 BAVUKISE
      coming soon template based on HTML5
      South Africa - 41.185.8.62
      Server software: Apache
      Technology: CSS, Google Font API, Html, Php, Google Analytics
      Number of Javascript: 5
      Number of meta tags: 5
    9. weekend365 - Home
      weekend365 ordnance survey map-based gifts
      San Francisco (United States) - 199.34.228.100
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Html5, Javascript, Google Analytics, Quantcast Measurement, Webly
      Number of Javascript: 5
      Number of meta tags: 3
    10. gulfdrug.net
      Road Town (Virgin Islands, British) - 208.91.197.132
      Server software: Apache
      Technology: Html
      Number of meta tags: 2

    Check Other Websites